PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016462879.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ZF-HD
Protein Properties Length: 238aa    MW: 26952.5 Da    PI: 8.0179
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016462879.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.71.2e-3250105359
     ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                     k +YkeClkNhA+ +GghavDGCgEfmp+ ge+g+ +alkCaAC+CHRnFHR+e++ 
  XP_016462879.1  50 KPKYKECLKNHAVGIGGHAVDGCGEFMPA-GEDGSLDALKCAACNCHRNFHRKETQI 105
                     679*************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-2252104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015669.6E-3152102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047708.6E-3052103IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.78753102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.606.5E-28147221IPR009057Homeodomain-like
SuperFamilySSF466892.69E-18153220IPR009057Homeodomain-like
TIGRFAMsTIGR015652.2E-24159215IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MEFETQEDQK EIRASPNYNS VLEISNSTNE PKMPSNSDEL ILDAPLQMRK PKYKECLKNH  60
AVGIGGHAVD GCGEFMPAGE DGSLDALKCA ACNCHRNFHR KETQIHHPPY YRTPPCGYFQ  120
HVMPPQRPLA LPSTSGGGGG GGYREDQEEM CNPNNSGTKK RFRTRFNQEQ KEKMLELAEN  180
LGWRIQRQDE GVVQQLCNEI GIKRHVFKVW MHNNKLTLGK KTLIQSISPS LFPAQERS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A8e-221582151673ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009802157.10.0PREDICTED: zinc-finger homeodomain protein 2-like isoform X1
RefseqXP_016462879.10.0PREDICTED: zinc-finger homeodomain protein 2-like isoform X1
SwissprotQ6YXH54e-69ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLM1C6691e-92M1C669_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000606233e-92(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.12e-66homeobox protein 22